TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P09182|IMMN_ECOLX Colicin-N immunity protein OS=Escherichia coli GN=cni PE=4 SV=1
MHNTLLEKIIAYLSLPGFHSLNNPPLSEAFNLYVHTAPLAATSLFIFTHKELELKPKSSPLRALKILTPFTILYISMIYC
FLLTDTELTLSSKTFVLIVKKRSVFVFFLYNTIYWDIYIHIFVLLVPYRNI