TCDB is operated by the Saier Lab Bioinformatics Group
>P0A3W8|VIRE2_AGRTU Single-strand DNA-binding protein - Agrobacterium tumefaciens.
MDLSGNEKSRPWKKANVSSSTISDIQMTNGENLESGSPTRTEVLSPRLDDGSVDSSSSLYSGSEHGNQAEIQKELSALFS
NMSLPGNDRRPDEYILVRQTGQDAFTGIAKGNLDHMPTKAEFNACCRLYRDGAGNYYPPPLAFDKISVPAQLEETWGMME
AKERNKLRFQYKLDVWNHAHADMGITGTEIFYQTDKNIKLDRNYKLRPEDRYVQTERYGRREIQKRYQHELQAGSLLPDI
MIKTPKNDIHFVYRFAGDNYANKQFSEFEHTVKRRYGGETEIKLKSKSGIMHDSKYLESWERGSADIRFAEFVGENRAHN
RQFPTATVNMGQQPDGQGGLTRDRHVSVEFLMQSAPNSPWAQALKKGELWDRVQLLARDGNRYLSPHRLEYSDPEHFTEL
MNRVGLPASMGRQSHAASIKFEKFDAQAAVIVINGPELRDIHDLSPENLQNVSTKDVIVADRNENGQRTGTYTSVAEYER
LQLRLPADAAGVLGEAADKYSRDFVRPEPASRPISDSRRIYESRPRSQSVNSF