TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0ABV8|TOLR_ECO57 Protein tolR OS=Escherichia coli O157:H7 GN=tolR PE=3 SV=1
MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEVDLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEK
DRLERLPPEQVVAEVSSRFKANPKTVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI