TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0ADP5|YIGM_ECOLI Uncharacterized membrane protein YigM OS=Escherichia coli (strain K12) GN=yigM PE=4 SV=1
MALLIITTILWAFSFSFYGEYLAGHVDSYFAVLVRVGLAALVFLPFLRTRGNSLKTVGLYMLVGAMQLGVMYMLSFRAYL
YLTVSELLLFTVLTPLYITLIYDIMSKRRLRWGYAFSALLAVIGAGIIRYDQVTDHFWTGLLLVQLSNITFAIGMVGYKR
LMETRPMPQHNAFAWFYLGAFLVAVIAWFLLGNAQKMPQTTLQWGILVFLGVVASGIGYFMWNYGATQVDAGTLGIMNNM
HVPAGLLVNLAIWHQQPHWPTFITGALVILASLWVHRKWVAPRSSQTADDRRRDCALSE