TCDB is operated by the Saier Lab Bioinformatics Group
>P0AEK7|FDNI_ECOLI Formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit - Escherichia coli.
MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFFGIAIFVALMFMFVRFVHHNI
PDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSIMSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGI
ILIHAILIHMYMAFWVKGSIKGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI