TCDB is operated by the Saier Lab Bioinformatics Group
>P0AG38|RHTC_ECOLI Threonine efflux protein - Escherichia coli.
MLMLFLTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGIALLGLHLIIEKMAWLHTLIMVGGGL
YLCWMGYQMLRGALKKEAVSAPAPQVELAKSGRSFLKGLLTNLANPKAIIYFGSVFSLFVGDNVGTTARWGIFALIIVET
LAWFTVVASLFALPQMRRGYQRLAKWIDGFAGALFAGFGIHLIISR