TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0AGM2|YICG_ECOLI UPF0126 inner membrane protein YicG OS=Escherichia coli (strain K12) GN=yicG PE=1 SV=1
MLLHILYLVGITAEAMTGALAAGRRRMDTFGVIIIATATAIGGGSVRDILLGHYPLGWVKHPEYVIIVATAAVLTTIVAP
VMPYLRKVFLVLDALGLVVFSIIGAQVALDMGHGPIIAVVAAVTTGVFGGVLRDMFCKRIPLVFQKELYAGVSFASAVLY
IALQHYVSNHDVVIISTLVFGFFARLLALRLKLGLPVFYYSHEGH