TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0C5A7|NS12_CVMA5 Non-structural protein of 12.7 kDa OS=Murine coronavirus (strain A59) GN=5a PE=3 SV=1
MRPTATWIWHVSDAWLRRTRDFGVIRLEDFCFQFNYSQPRVGYCRVPLKAWCSNQGKFAAQFTLKSCEKPGHEKFITSFT
AYGRTVQQAVSKLVEEAVDFILFRATQLERNV