TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0C6C9|TCPE_VIBCH Toxin coregulated pilus biosynthesis protein E OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tcpE PE=3 SV=1
MKIISKKYRLELYSMLVDLLNDNIPLYDALNKIQNEGVGIYDKNFIKSIELIKDRMKSNSSLTDALTGLIPDKEVLMINV
AENSGKISSGIAAIRKNIIDADEIKSKAISSMITPSVMLIVTMVVIAGYSVKVFPTFESVLPVSRWPGVTQALYNLGFSL
YEGLWIKVLIFVAIFITILVFMSKNITGNFRDGFLDKLPPFNFVKHIAATEFLANMSMLLDSRVPFKEGLDIVDHKTTRW
LSSHLQRMKANMQEGLDYKQALDTNLLDKKMLLTMAVYSELPNFSDVMQKLAIEANINLHKKIATLAGVMKNISLITLAL
SVIWIFGAIFSLVDKLSSSL