TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0C6T2|OST4_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 OS=Homo sapiens OX=9606 GN=OST4 PE=1 SV=1
MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE