TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0C6Y6|E_PRRSL Envelope small membrane protein OS=Porcine reproductive and respiratory syndrome virus (strain Lelystad) OX=11049 GN=GP2b PE=1 SV=1
MGSLWSKISQLFVDAFTEFLVSVVDIAIFLAILFGFTVAGWLLVFLLRVVCSALLRSRSAIHSPELSKVL