TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0C8L3|BPK_HADGE Bradykinin-potentiating peptide-like OS=Hadrurus gertschi PE=2 SV=1
MNAKAFLAIFMIALLITDRAEAGWWNAFKSIGKKLLKSKLAKDITKMAKQRAKEYVVKKLNGPPEEEVAAIDALMNSLDY