TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P10565|BINB1_LYSSH Larvicidal toxin 51 kDa protein OS=Lysinibacillus sphaericus GN=binB PE=4 SV=1
MCDSKDNSGVSEKCGKKFTNYPLNTTPTSLNYNLPEISKKFYNLKNKYSRNGYGLSKTEFPSSIENCPSNEYSIMYDNKD
PRFLIRFLLDDGRYIIADRDDGEVFDEAPTYLDNNNHPIISRHYTGEERQKFEQVGSGDYITGEQFFQFYTQNKTRVLSN
CRALDSRTILLSTAKIFPIYPPASETQLTAFVNSSFYAAAIPQLPQTSLLENIPEPTSLDDSGVLPKDAVRAVKGSALLP
CIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYIGADFGMLFYFRSS
GFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGEIVKNWVAVDYRLAGIQSYPNAPI
TNPLTLTKHTIIRCENSYDGHIFKTPLIFKNGEVIVKTNEELIPKINQ