TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P10927|VG09_BPT4 Baseplate structural protein Gp9 OS=Enterobacteria phage T4 GN=9 PE=1 SV=1
MFIQEPKKLIDTGEIGNASTGDILFDGGNKINSDFNAIYNAFGDQRKMAVANGTGADGQIIHATGYYQKHSITEYATPVK
VGTRHDIDTSTVGVKVIIERGELGDCVEFINSNGSISVTNPLTIQAIDSIKGVSGNLVVTSPYSKVTLRCISSDNSTSVW
NYSIESMFGQKESPAEGTWNISTSGSVDIPLFHRTEYNMAKLLVTCQSVDGRKIKTAEINILVDTVNSEVISSEYAVMRV
GNETEEDEIANIAFSIKENYVTATISSSTVGMRAAVKVIATQKIGVAQ