TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P10928|VG10_BPT4 Baseplate structural protein Gp10 OS=Enterobacteria phage T4 GN=10 PE=1 SV=1
MKQNINIGNVVDDGTGDYLRKGGIKINENFDELYYELGDGDVPYSAGAWKTYNASSGQTLTAEWGKSYAINTSSGRVTIN
LPKGTVNDYNKVIRARDVFATWNVNPVTLVAASGDTIKGSAVPVEINVRFSDLELVYCAPGRWEYVKNKQIDKITSSDIS
NVARKEFLVEVQGQTDFLDVFRGTSYNVNNIRVKHRGNELYYGDVFSENSDFGSPGENEGELVPLDGFNIRLRQPCNIGD
TVQIETFMDGVSQWRSSYTRRQIRLLDSKLTSKTSLEGSIYVTDLSTMKSIPFSAFGLIPGEPINPNSLEVRFNGILQEL
AGTVGMPLFHCVGADSDDEVECSVLGGTWEQSHTDYSVETDENGIPEILHFDSVFEHGDIINITWFNNDLGTLLTKDEII
DETDNLYVSQGPGVDISGDVNLTDFDKIGWPNVEAVQSYQRAFNAVSNIFDTIYPIGTIYENAVNPNNPVTYMGFGSWKL
FGQGKVLVGWNEDISDPNFALNNNDLDSGGNPSHTAGGTGGSTSVTLENANLPATETDEEVLIVDENGSVIVGGCQYDPD
ESGPIYTKYREAKASTNSTHTPPTSITNIQPYITVYRWIRIA