TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P10930|VG12_BPT4 Short tail fiber protein OS=Enterobacteria phage T4 GN=12 PE=1 SV=3
MSNNTYQHVSNESRYVKFDPTDTNFPPEITDVQAAIAAISPAGVNGVPDASSTTKGILFIPTEQEVIDGTNNTKAVTPAT
LATRLSYPNATETVYGLTRYSTNDEAIAGVNNESSITPAKFTVALNNAFETRVSTESSNGVIKISSLPQALAGADDTTAM
TPLKTQQLAIKLIAQIAPSETTATESDQGVVQLATVAQVRQGTLREGYAISPYTFMNSSSTEEYKGVIKLGTQSEVNSNN
ASVAVTGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIQQRGGQIIYGTLRIEDTFTIANGGANITGTVR
MTGGYIQGNRIVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRIGTRYGGNPSNPGLPDMRGLFV
RGSGRGSHLTNPNVNGNDQFGKPRLGVGCTGGYVGEVQIQQMSYHKHAGGFGEHDDLGAFGNTRRSNFVGTRKGLDWDNR
SYFTNDGYEIDPESQRNSKYTLNRPELIGNETRPWNISLNYIIKVKE