TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P11112|VG15_BPT4 Tail connector protein Gp15 OS=Enterobacteria phage T4 GN=15 PE=1 SV=2
MFGYFYNSSFRRYATLMGDLFSNIQIKRQLESGDKFIRVPITYASKEHFMMKLNKWTSINSQEDVAKVETILPRINLHLV
DFSYNAPFKTNILNQNLLQKGATSVVSQYNPSPIKMIYELSIFTRYEDDMFQIVEQILPYFQPHFNTTMYEQFGNDIPFK
RDIKIVLMSAAIDEAIDGDNLSRRRIEWSLTFEVNGWMYPPVDDAEGLIRTTYTDFHANTRDLPDGEGVFESVDSEVVPR
DIDPEDWDGTVKQTFTSNVNRPTPPEPPGPRT