TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P12520|VPR_HV1N5 VPR protein (R ORF protein) - Human immunodeficiency virus type 1 (New York-5 isolate) (HIV-1).
MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRIWLHNLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSR
IGVTRQRRARNGASRS