TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13331|VG03_BPT4 Tail sheath-stabilizing protein Gp3 OS=Enterobacteria phage T4 GN=3 PE=4 SV=3
MSQALQQIFNQANTTNFVVSIPHSNTTSAFTLNAQSVPIPGIRIPVTDTVTGPFGLGRAQRPGVTFEYDPLIVRFIVDEE
LKSWIGMYEWMLGTSNYLTGENTAQKTGPEYITLYILDNSKTEIVMSINFYKPWVSDLSEVEFSYTEDSDPALVCTATIP
YTYFQVEKDGKIIAEV