TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13332|VG18_BPT4 Tail sheath protein Gp18 OS=Enterobacteria phage T4 GN=18 PE=1 SV=5
MTLLSPGIELKETTVQSTVVNNSTGTAALAGKFQWGPAFQIKQVTNEVDLVNTFGQPTAETADYFMSAMNFLQYGNDLRV
VRAVDRDTAKNSSPIAGNIDYTISTPGSNYAVGDKITVKYVSDDIETEGKITEVDADGKIKKINIPTGKNYAKAKEVGEY
PTLGSNWTAEISSSSSGLAAVITLGKIITDSGILLAEIENAEAAMTAVDFQANLKKYGIPGVVALYPGELGDKIEIEIVS
KADYAKGASALLPIYPGGGTRASTAKAVFGYGPQTDSQYAIIVRRNDAIVQSVVLSTKRGEKDIYDSNIYIDDFFAKGGS
EYIFATAQNWPEGFSGILTLSGGLSSNAEVTAGDLMEAWDFFADRESVDVQLFIAGSCAGESLETASTVQKHVVSIGDAR
QDCLVLCSPPRETVVGIPVTRAVDNLVNWRTAAGSYTDNNFNISSTYAAIDGNHKYQYDKYNDVNRWVPLAADIAGLCAR
TDNVSQTWMSPAGYNRGQILNVIKLAIETRQAQRDRLYQEAINPVTGTGGDGYVLYGDKTATSVPSPFDRINVRRLFNML
KTNIGRSSKYRLFELNNAFTRSSFRTETAQYLQGNKALGGIYEYRVVCDTTNNTPSVIDRNEFVATFYIQPARSINYITL
NFVATATGADFDELTGLAG