TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13333|VG19_BPT4 Tail tube protein Gp19 OS=Enterobacteria phage T4 GN=19 PE=1 SV=1
MFVDDVTRAFESGDFARPNLFQVEISYLGQNFTFQCKATALPAGIVEKIPVGFMNRKINVAGDRTFDDWTVTVMNDEAHD
ARQKFVDWQSIAAGQGNEITGGKPAEYKKSAIVRQYARDAKTVTKEIEIKGLWPTNVGELQLDWDSNNEIQTFEVTLALD
YWE