TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13335|VG26_BPT4 Baseplate structural protein Gp26 OS=Enterobacteria phage T4 GN=26 PE=4 SV=2
MYEYKFDVRVGSKIINCRAFTLKEYLELITAKNNGSVEVIVKKLIKDCTNAKDLNRQESELLLIHLWAHSLGEVNHENSW
KCTCGTEIPTHINLLHTQIDAPEDLWYTLGDIKIKFRYPKIFDDKNIAHMIVSCIETIHANGESIPVEDLNEKELEDLYS
IITESDIVAIKDMLLKPTVYLAVPIKCPECGKTHAHVIRGLKEFFELL