TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13336|VG28_BPT4 Baseplate structural protein Gp28 OS=Enterobacteria phage T4 GN=28 PE=4 SV=4
MNLNLILPLKKVVLPISNKEVSIPKMGLKHYNILKDVKGPDENLKLLIDSICPNLSPAEVDFVSIHLLEFNGKIKSRKEI
DGYTYDINDVYVCQRLEFQYQGNTFYFRPPGKFEQFLTVSDMLSKCLLRVNDEVKEINFLEMPAFVLKWANDIFTTLAIP
GPNGPITGIGNIIGLFE