TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13337|VG29_BPT4 Tail-tube assembly protein Gp29 OS=Enterobacteria phage T4 GN=29 PE=4 SV=1
MKKPQEMQTMRRKVISDNKPTQEAAKSASNTLSGLNDISTKLDDAQAASELIAQTVEEKSNEIIGAIDNVESAVSDTSAG
SELIAETVEIGNNINKEIGESLGSKLDKLTSLLEQKIQTAGIQQTGTSLATVESAIPVKVVEDDTAESVGPLLPAPEAVN
NDPDADFFPTPQPVEPKQESPEEKQKKEAFNLKLSQALDKLTKTVDFGFKKSISITDKISSMLFKYTVSAAIEAAKMTAM
ILAVVVGIDLLMIHFKYWSDKFSKAWDLFSTDFTKFSSETGTWGPLLQSIFDSIDKIKQLWEAGDWGGLTVAIVEGLGKV
LFNLGELIQLGMAKLSAAILRVIPGMKDTADEVEGRALENFQNSTGASLNKEDQEKVANYQDKRMNGDLGPIAEGLDKIS
NWKTRASNWIRGVDNKEALTTDEERAAEEEKLKQLSPEERKNALMKANEARAAMIRFEKYADSADMSKDSTVKSVEAAYE
DLKKRMDDPDLNNSPAVKKELAARFSKIDATYQELKKNQPNAKPETSAKSPEAKQVQVIEKNKAQQAPVQQASPSINNTN
NVIKKNTVVHNMTPVTSTTAPGVFDATGVN