TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13339|VG48_BPT4 Tail-tube assembly protein Gp48 OS=Enterobacteria phage T4 GN=48 PE=1 SV=3
MAIVKEITADLIKKSGEKISAGQSTKSEVGTKTYTAQFPTGRASGNDTTEDFQVTDLYKNGLLFTAYNMSSRDSGSLRSM
RSNYSSSSSSILRTARNTISSTVSKLSNGLISNNNSGTISKSPIANILLPRSKSDVDTSSHRFNDVQESLISRGGGTATG
VLSNIASTAVFGALESITQGIMADNNEQIYTTARSMYGGAENRTKVFTWDLTPRSTEDLMAIINIYQYFNYFSYGETGKS
QYAAEIKGYLDDWYRSTLIEPLSPEDAAKNKTLFEKMTSSLTNVLVVSNPTVWMVKNFGATSKFDGKTEIFGPCQIQSIR
FDKTPNGNFNGLAIAPNLPSTFTLEITMREIITLNRASLYAGTF