TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P13341|VG54_BPT4 Tail-tube assembly protein Gp54 OS=Enterobacteria phage T4 GN=54 PE=4 SV=1
MYSLEEFNNQAINADFQRNNMFSCVFATTPSTKSSSLISSISNFSYNNLGLNSDWLGLTQGDINQGITTLITAGTQKLIR
KSGVSKYLIGAMSQRTVQSLLGSFTVGTYLIDFFNMAYNSSGLMIYSVKMPENRLSYETDWNYNSPNIRITGRELDPLVI
SFRMDSEACNYRAMQDWVNSVQDPVTGLRALPQDVEADIQVNLHSRNGLPHTAVMFTMHSISVSAPELSYDGDNQITTFD
VTFAYRVMQAGAVDRQRALEWLESAAINGIQSVLGNSGGVTGLSNSLSRLSRLGGTAGSISNINTMTGIVNSQSKILGAI