TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P14182|LICB_HAEIN Protein licB - Haemophilus influenzae.
MRGYLFGILSAVFWALSGLLYNELPLSEYTALGKVISLLFLIDFCSLLVIGITLWRKSAVDFQGVFWQPALSGILGGPIG
MSAYLLSIHYLTIYYAAPLSSLFPVFAALMSYWILKEKITKTAQFGFALAIISSSLLAIEVGQEITFNTIGFIFLIICIL
GWSSEIVISSYTMRSLSGLQVYFLRLCGSTIGYLLILFILSLKNFSLDILSFNYVQIAGVIIFGALSYCCYYQAIYLLKP
IKAMALNITYSVWAIGLGYLLYKQPIKPITLLLTLLLSAGVIVTLYYKGEQK