TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P14665|CEC5_MANSE BACTERICIDIN B-5P PRECURSOR (CECROPIN-LIKE PEPTIDE B-5) - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm).
MNFSRVLFFVFACLSAFAMASAAPWNPFKELERAGQRVRDAVISAAAVATVGQAAAIARGG