TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P16011|VG53_BPT4 Baseplate structural protein Gp53 OS=Enterobacteria phage T4 GN=53 PE=4 SV=1
MLFTFFDPIEYAAKTVNKNAPTIPMTDIFRNYKDYFKRALAGYRLRTYYIKGSPRPEELANAIYGNPQLYWVLLMCNDNY
DPYYGWITSQEAAYQASIQKYKNVGGDQIVYHVNENGEKFYNLISYDDNPYVWYDKGDKARKYPQYEGALAAVDTYEAAV
LENEKLRQIKIIAKSDINSFMNDLIRIMEKSYGNDK