TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P16573|ECTO_RAT ECTO-ATPASE PRECURSOR (CELL-CAM 105) (C-CAM 105) (ATP-DEPENDENT TAUROCOLATE-CARRIER PROTEIN) (GP110) - Rattus norvegicus (Rat).
MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEESSVLLLTHNLPQEFQVFYWYKVTTTGLNSEIA
RYIRSSNTSQTEPAYSGRVTIYSNGSLFFQNVNKTDEGPYTLSVIDKQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGE
PFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAP
VISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFE
PVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSF
RISHPIKLDVIPDPTQGNSGLSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGGSDHRDLTEHKPSTSSHNLGPSDDSP
NKVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK