TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P18002|IMMM_ECOLX Colicin-M immunity protein OS=Escherichia coli GN=cmi PE=1 SV=2
MLTLYGYIRNVFLYRMNDRSCGDFMKVISMKFIFILTIIALAAVFFWSEDKGPACYQVSDEQARTFVKNDYLQRMKRWDN
DVQLLGTEIPKITWEKIERSLTDVEDEKTLLVPFKAEGPDGKRMYYGMYHCEEGYVEYAND