TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P19060|VG06_BPT4 Baseplate structural protein Gp6 OS=Enterobacteria phage T4 GN=6 PE=1 SV=1
MANTPVNYQLTRTANAIPEIFVGGTFAEIKQNLIEWLNGQNEFLDYDFEGSRLNVLCDLLAYNTLYIQQFGNAAVYESFM
RTANLRSSVVQAAQDNGYLPTSKSAAQTEIMLTCTDALNRNYITIPRGTRFLAYAKDTSVNPYNFVSREDVIAIRDKNNQ
YFPRLKLAQGRIVRTEIIYDKLTPIIIYDKNIDRNQVKLYVDGAEWINWTRKSMVHAGSTSTIYYMRETIDGNTEFYFGE
GEISVNASEGALTANYIGGLKPTQNSTIVIEYISTNGADANGAVGFSYADTLTNITVININENPNDDPDFVGADGGGDPE
DIERIRELGTIKRETQQRCVTATDYDTFVSERFGSIIQAVQTFTDSTKPGYAFIAAKPKSGLYLTTVQREDIKNYLKDYN
LAPITPSIISPNYLFIKTNLKVTYALNKLQESEQWLEGQIIDKIDRYYTEDVEIFNSSFAKSKMLTYVDDADHSVIGSSA
TIQMVREVQNFYKTPEAGIKYNNQIKDRSMESNTFSFNSGRKVVNPDTGLEEDVLYDVRIVSTDRDSKGIGKVIIGPFAS
GDVTENENIQPYTGNDFNKLANSDGRDKYYVIGEINYPADVIYWNIAKINLTSEKFEVQTIELYSDPTDDVIFTRDGSLI
VFENDLRPQYLTIDLEPISQ