TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P19061|VG07_BPT4 Baseplate structural protein Gp7 OS=Enterobacteria phage T4 GN=7 PE=4 SV=1
MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTNSGENLPSNQYRWINLGYTANNSFFFDDADPLTTYII
RVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLANKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDV
SSISNFIIGENEYHEIQGSIQQVCKDINRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVYYQ
SANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYATLPANVYRIAEAITCTDDYIYV
VARDKVRYIKTSNALIDFDPLSPTYSERLFEPDTMTITGNPKAVCYKMDSICDKVFALIIGEVETLNANPRTSKIIDSAD
KGIYVLNHDEKTWKRVFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAAKYQLIGAVKYEFPREWL
ADKHYHMMAFIADETSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDRAVVVYADLKYTKVIENIPETSPDRLVHEY
WDDGDCTIVMPNVKFTGFKKYASGMLFYKASGEIISYYDFNYRVRDTVEIIWKPTEVFLKAFLQNQEHETPWSPEEERGL
ADPDLRPLIGTMMPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRNIYLNADKR
DAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIVQSDSLTEDLVGQTIYTATGRCNVTYIER
SYSNGKLQWTVTIHNLLGRLIAGQEVKAERLPSFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVI
RFVHPVGFGFIAITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRIAKLTPTGEIEHDSVTGEAIYEPGPMAG
VKYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRLKDNIGNPRDPENPTQVKIDE