TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P19062|VG08_BPT4 Baseplate structural protein Gp8 OS=Enterobacteria phage T4 GN=8 PE=1 SV=1
MNDSSVIYRAIVTSKFRTEKMLNFYNSIGSGPDKNTIFITFGRSEPWSSNENEVGFAPPYPTDSVLGVTDMWTHMMGTVK
VLPSMLDAVIPRRDWGDTRYPDPYTFRINDIVVCNSAPYNATESGAGWLVYRCLDVPDTGMCSIASLTDKDECLKLGGKW
TPSARSMTPPEGRGDAEGTIEPGDGYVWEYLFEIPPDVSINRCTNEYIVVPWPEELKEDPTRWGYEDNLTWQQDDFGLIY
RVKANTIRFKAYLDSVYFPEAALPGNKGFRQISIITNPLEAKAHPNDPNVKAEKDYYDPEDLMRHSGEMIYMENRPPIIM
AMDQTEEINILFTF