TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P22749|GNLY_HUMAN GRANULYSIN PRECURSOR (NKG5 PROTEIN) (LYMPHOKINE LAG-2) (T-CELL ACTIVATION PROTEIN 519) - Homo sapiens (Human).
MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMV
DKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL