TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P23895|EMRE_ECOLI EmrE protein (Methyl viologen resistance protein C) (Ethidium resistance protein) - Escherichia coli.
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG
QRLDLPAIIGMMLICAGVLIINLLSRSTPH