TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P25014|SECY_CYAPA PREPROTEIN TRANSLOCASE SECY SUBUNIT - Cyanophora paradoxa.
MLSRLIISIFIIFETIYLQIFKPVNKTFKQGEAKLKRTLQTLQSRELSEIRKRAISTLCLIFLIRIGTFLPIPGTALNFD
LESFQQNNSRNELANILNLLSGGAFLEIGFFTLGILPYMNASFFLQVLTKILPSLERFQKEQEEIAQREFKKWTRYLTVI
WAFIQSIVISWIWIRPYALNWDFFLGLKVVVALTLGAVIVMIIAEQITEIGLTNGSSLLIFINIIARIPNSIEQLFNSNI
NWTFPMISSLILSLSLSFITMFVIIGLQESGRPVPVLIARQEAERQKFNEPITEAERRKTQAYIFFQLLPAGIMPVIFAS
TIFDLALPAFTNFLLQQGNWGYQLIKSFPFNSLFKDFCYLITIMLFSSNYALTIMINPKTLAENLNSMNALIPGVRPGSE
TKVYSEQLIHRLNFIGSFVLALVCILPSIVERSLGLPKLQILSPVSISIALGVAVDTTRRITSYLGSSSPFKRDSSKREP
LKRDFSKRRSAN