TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P28542|SECY_HALMA PREPROTEIN TRANSLOCASE SECY SUBUNIT - Haloarcula marismortui (Halobacterium marismortui).
MSWKDTAEPLLVRMPAVQRPEGHVPFKRKLTWTGGVLLLYFFLTNVKLFGLDIDASQQVFGRFSSILASGQGSIMQLGIG
PIVTASIVLQLLGGADLLGLNTQDDPRDQILYQGLQKLLVLVMICLTGLPMVFAGGFLPADTAVANSLGIGTAGVQWLIF
AQMFVGGVLILFMDEVISKWGVGSGIGLFIVAGVSQRLVGGLLTAPFLGNSEGIIYTWYLFITGERGTGPVLAADGLQTV
LLQGELLGLFTTVLIFAVVVYAESVRVEIPLSNARVKGARGRFPVKLIYASVLPMILVRALQANIQFLGRILNAQLGSMP
AFLGTYANGQPTGGLFYFLAPIQSRGDWMWWLEGTAQPVWQILTRVGIDLFVMLVGGAVFAVFWVETTDMGPEATAKQIH
NSGMQIPGFRQNVGVIEKVLERYIPQVTVIGGALVGLLAVMANMLGTIGGVSGTGLLLTVSITYKLYEEIAEEQLMEMHP
MMRQMFG