TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P29939|YCB6_PSEDE Hypothetical 15.0 kDa protein IN COBO 3'region (ORF6) - Pseudomonas denitrificans.
MSQSWQFWALLSAAFAALTAVFAKVGVAQINSDFATLIRTVVILCVIAAIVAATGQWQKPSEIPGRTWLFLALSGLATGA
SWLAYFRALKLGDAARVAPLDKLSIVMVAIFGVLFLGEKLNLMNWLGVAFIAAGALLLAVF