TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P32089|TXTP_RAT TRICARBOXYLATE TRANSPORT PROTEIN PRECURSOR (CITRATE TRANSPORT PROTEIN) (CTP) (TRICARBOXYLATE CARRIER PROTEIN) - Rattus norvegicus (Rat).
MAAPRAPRALTAAAPGSGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERANPPRYRGIGDCVRQTVRSHGV
LGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSRRGLLCGLGAGVAEAVVVVCPMETVKVKFIHDQTSSNPK
YRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYQGDNPNKPMNPLITGVFGAVAGAASVFGNTP
LDVIKTRMQGLEAHKYRNTLDCGVQILKNEGPKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD