TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P34095|PFPA_ENTHI PORE-FORMING PEPTIDE AMEOBAPORE A PRECURSOR (EH-APP) - Entamoeba histolytica.
MKAIVFVLIFAVAFAVTATHQGEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQ
LIEDKVDANAICAKIHAC