TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P35522|CICH_TORCA Chloride channel protein OS=Torpedo californica PE=1 SV=3
MSHEKNEASGNPEAQSWKAQEAMLGVKTEVSRWRAVKNCLYRHLVKVLGEDWIFLLLLGALMALVSWAMDFIGSRGLRFY
KYLFAMVEGNLGLQYLVWVCYPLILILFSSLFCQIVSPQAVGSGIPELKTIIRGAVLHEYLTLRTFVAKTVGLTVALSAG
FPLGKEGPFVHIASICATLLNQLLCFISGRREEPYYLRADILTVGCALGISCCFGTPLAGVLFSIEVTCSHFGVRSYWRG
FLGGAFSAFIFRVLSVWVKDTVTLTALFKTNFRGDIPFDLQELPAFAIIGIASGFFGALFVYLNRQIIVFMRKKNFVTKI
LKKQRLIYPAVVTFVLATLRFPPGVGQFFGAGLMPRETINSLFDNYTWTKTIDPRGLGNSAQWFIPHLNIFIVMALYFVM
HFWMAALAVTMPVPCGAFVPVFNLGAVLGRFVGELMALLFPDGLVSNGNLYHILPGEYAVIGAAAMTGAVTHAVSTAVIC
FELTGQISHVLPMMVAVILANMVAQGLQPSLYDSIIQIKKLPYLPELSWSSANKYNIQVGDIMVRDVTSIASTSTYGDLL
HVLRQTKLKFFPFVDTPETNTLLGSIERTEVEGLLQRRISAYRRQPATAAEAEEEGRNGERGASFTGDVPGEAETSFAYI
DQEEAEGQQQREGLEAVKVQTEDPRPPSPVPAEEPTQTSGIYQKKHKGTGQVASRFEEMLTLEEIYQWEQREKNVVVNFE
TCRIDQSPFQLVEGTSLQKTHTLFSLLGLDRAYVTSMGKLVGVVALAEIQAAIEGSYQKGFRLPPPLASFRDAKNARNSG
RTATSNSSGK