TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P35526|CICP_BOVIN CHLORINE CHANNEL PROTEIN P64 - Bos taurus (Bovine).
MNDENYSTTIYNRVQTERVYEDSDPAENGGPLYDEVHEDVRREDNLYVNELENQEYDSVAVYPVGRQGRTSASLQPETGE
YVLPDEPYSKAQDPHPGEPTADEDISLEELLSPTKDHQSDSEEPQASDPEEPQASDPEEPQGPDPEEPQENGNEMEADLP
SPSSFTIQNSRAFSTREISPTSYSADDVSEGNESASASPEINLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVD
LKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPRLAAKHRESNTAGIDIFVKFSAYIKNTKQQSNA
ALERGLTKALKKLDDYLNTPLPEEIDADTRGDDEKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDFPAEMTGL
WRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS