TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P37108|SR14_HUMAN Signal recognition particle 14 kDa protein (SRP14) (18 kDa ALU RNA binding protein) - Homo sapiens (Human).
MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQ
MAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ