TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P39649|YWFM_BACSU Hypothetical 31.3 kDa protein IN PTA 3'region - Bacillus subtilis.
MKGNIYSLFVLIAAFFWGTTGTVQALAPESATPLAFGAFRLLIGGSAMLLAVWISRELHVKNWAWPLVFLAAVCMACYQP
LFFTAVKETGIAVGTVIAIGSAPIIAGTLEWAVLKKRPRNSWWIATVLALAGCWLLFSDSSNVRIDVAGVLMALGAGASF
AGYTLISKAMMKTQPPRATSAVVFMISAILLTPLLWQLDISWILTPRGLGTSLYIGLIATCAAYFLFAKGLTGVPASAAV
TLSLAEPLTASLLGVFFIGEMLSPSSWLGIALMMLGLLVISAAPRKQKTAEAAHMS