TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P40420|GLCU_BACSU Glucose uptake protein GlcU OS=Bacillus subtilis (strain 168) GN=glcU PE=2 SV=2
MDLLLALLPALFWGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVIYFFVQPVLSLRIFIVGIVSGLFWSLGQANQLKSIQ
LMGVSKTMPISTGMQLVSTSLFGVIVFREWSTPIAITLGVLALIFIIVGIILTSLEDKNDKKEGEPSNLKKGILILLVST
LGYLVYVVVARLFNVSGWSALLPQAIGMVVGGLVLTYRHKPFNKYAIRNILPGLIWAGGNMFLFISQPRVGVATSFSLSQ
MGIVISTLGGIFILREKKTKRQLIAIAIGIILIIAAAVFLGIAKTNS