TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P40464|FLX1_YEAST MITOCHONDRIAL FAD CARRIER PROTEIN FLX1 - Saccharomyces cerevisiae (Baker's yeast).
MVDHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNELYRGLSIN
LFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGA
QGAYTSMYNGVQQLLRTDGFQGLWKGLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVS
VTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVYENLKHRL