TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P40540|EMC5_YEAST ER membrane protein complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMC5 PE=1 SV=1
MSFVSKLLYTVSALVLFHSGFSSYEFHHLLKLNSLNNAQGAISKLPKDIMYETYAGLILFVLAVFTSFEKLQYLPIESND
GKIISQGNYLKEIALNKATNVDNLIGSNPNGEIIFTPSFVDVHMKRKICREWASNTVKKEK