TCDB is operated by the Saier Lab Bioinformatics Group
>P44408|REC2_HAEIN Recombination protein 2 - Haemophilus influenzae.
MKLNLITLVVLLIVADLTLLFLPQPLLLPWQVALVIALVLIFLFIFLRRNFLVSLAFFVASLGYFHYSALSLSQQAQNIT
AQKQVVTFKIQEILHQQDYQTLIATATLENNLQEQRIFLNWKAKEVPQLSEIWQAEISLRSLSARLNFGGFDRQQWYFSK
GITAVGTVKSAVKIADVSSLRAEKLQQVKKQTEGLSLQGLLIALAFGERAWLDKTTWSIYQQTNTAHLIAISGLHIGLAM
GIGFCLARVVQVFFPTRFIHPYFPLVFGVLFALIYAYLAGFSVPTFRAISALVFVLFIQIMRRHYSPIQFFTLVVGFLLF
CDPLMPLSVSFWLSCGAVGCLLLWYRYVPFSLFQWKNRPFSPKVRWIFSLFHLQFGLLLFFTPLQLFLFNGLSLSGFLAN
FMAVPIYSFLLVPLILFAVFTNGTMFSWQLANKLAEGITGLISVFQGNWLTVSFNLALGLTALCAGIFMLIIWNIYREPE
ISSSNWQIKRAKFFTLNLSKPLLKNERINVLRCSFGIILLCFTILLFKQLSKPTWQVDTLDVGQGLATLIVKNGKGILYD
TGSSWRGGSMAELEILPYLQREGIVLEKLILSHDDNDHAGGASTILKAYPNVELITPSRKNYGENYRTFCTAGRDWHWQG
LHFQILSPHNVVTRADNSHSCVILVDDGKNSVLLTGDAEAKNEQIFARTLGKIDVLQVGHHGSKTSTSEYLLSQVRPDVA
IISSGRWNPWKFPHYSVMERLHRYKSAVENTAVSGQVRVNFFQDRLEIQQARTKFSPWYARVIGLSKE