TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P46058|EDSP_CYNPY Epidermal differentiation-specific protein OS=Cynops pyrrhogaster OX=8330 PE=2 SV=1
MNTITVYEHSNFQGLHKTFTSDVPNLVNESFNDCISSVKIVGQPWILHQDINYSGQCLPLEEGEYSGISMNDGASSLRLI
TDDLSNPQITVYEHVNGGGKALVLTEETNLAFGNMHDNISSHRVQRGAWALYEHINRGGRCIVARAGEYLANYCTIGFND
QVSHVYPLRAGKTSVTATILWDRKKVESERNVQIDQYFYTNNTSIEQQFTATSTKEFEKYVSHSFEFSNETSIKVGTSFT
LKGVVDINTEVSNTFTVKKGETESFTTRKKAELSMPVKAPPRSKLTVNFMCKEITISVPVELKIVRGSKTDIETGTYRCE
SGTETYIDVQSLPIS